Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
Common carp Protein: Cyp c 1 | β-Parvalbumin
Empirical Proteotypic Peptide Explorer:
This rose plot enables visualization of proteotypic peptides. Each colored rose petal corresponds to a peptide and is bounded by thin gray petals, which represent tryptic cut sites. The radial magnitude of each peptide corresponds to the number of publications which report it.
Hover over a rose petal with your mouse to see the peptide. Click on a rose petal to see the species specificity of that peptide and add it to your cart.
Sequence - 109 amino acids
MAFAGILNDADITAALQGCQAADSFDYKSFFAKVGLSAKTPDDIKKAFAVIDQDKSGFIEEDELKLFLQNFSAGARALTDAETKAFLKAGDSDGDGKIGVDEFAALVKA
UniProt: Q8UUS3 IUIS: Cyp c 1Peptide Selector Tool
Explore peptide targets for mass spectrometry by adjusting the selection criteria below. Results from empirical and computational prediction tools have been aggregated for convenience.
Minimum length:
Maximum length:
| 1 | Peptide | 2 | Exp.3 | ESP4 | CONSeQ5 |
|---|---|---|---|---|---|
| ^ | MAFAGILNDADITAALQGCQAADSFDYK | S | 0 | 0.383 | 0.05236 |
| K | AFAVIDQDK | S | 0 | 0.389 | 0.6142 |
| K | SGFIEEDELK | L | 0 | 0.436 | 0.60546 |
| K | LFLQNFSAGAR | A | 0 | 0.597 | 0.47208 |
| R | ALTDAETK | A | 0 | 0.23 | 0.4154 |
| K | AGDSDGDGK | I | 0 | 0.236 | 0.13786 |
| K | IGVDEFAALVK | A | 0 | 0.576 | 0.56652 |
| ^ | MAFAGVLNDADITAALEACK | A | 0 | 0.565 | 0.11462 |
| K | AADSFNHK | T | 0 | 0.28 | 0.17708 |
| K | AFAIIDQDK | S | 0 | 0.378 | 0.52184 |
| K | SGFIEEDELK | L | 0 | 0.436 | 0.60546 |
| K | LFLQNFK | A | 0 | 0.32 | 0.19254 |
| R | ALTDGETK | T | 0 | 0.21 | 0.2659 |
| K | AGDSDGDGK | I | 0 | 0.236 | 0.13786 |
| K | IGVDEFTALVK | A | 0 | 0.562 | 0.5675 |
1 Previous amino acid (^ = Start of protein)
2 Next amino acid ($ = End of protein)
3 Exp. = Number of publications in which this peptide has been reported experimentally
4 ESP = ESP Predictor. Fusaro VA, et al. Nat Botechnol 2009; 27(2): 190-198. doi
5 CONSeQ = CONSeQuence. Eyers CE, et al. Mol Cell Proteomics 2011; 10(11). doi
Underline: Peptide occurs within the first 20 amino acids from the start of the protein. Use caution as the protein may contain a cleaved signaling sequence.
Strike-through: Peptide is present in a protein from another allergen species and is thus nonspecific.